PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100072310011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family NAC
Protein Properties Length: 185aa    MW: 21517.6 Da    PI: 9.5148
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100072310011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM143.21.5e-4441361128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknr 76 
                                   +p GfrF Pt+eelv++yL++k+e+++  ++++vi+ +diy+++Pw+L+k     +++e+++w+fF++r++++ +g r++r
  Ote100072310011|100072310011   4 VPTGFRFFPTEEELVSFYLHNKLEDDQtSSINRVIPVLDIYQLDPWHLRKycgeFCHGESEQWFFFMPRQEREVRGGRPSR 84 
                                   589********************99994566778**************9646653444778******************** PP

                           NAM  77 atksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +t+sgyWkatg+ + v+s++++++g+kk++vfykg+ap+g+kt+W m+eyr+
  Ote100072310011|100072310011  85 TTASGYWKATGSPTYVYSSENKVIGVKKSMVFYKGKAPTGRKTKWKMNEYRA 136
                                   **************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-473159IPR003441NAC domain
PROSITE profilePS5100546.3154160IPR003441NAC domain
PfamPF023651.8E-235135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MEEVPTGFRF FPTEEELVSF YLHNKLEDDQ TSSINRVIPV LDIYQLDPWH LRKYCGEFCH  60
GESEQWFFFM PRQEREVRGG RPSRTTASGY WKATGSPTYV YSSENKVIGV KKSMVFYKGK  120
APTGRKTKWK MNEYRAIKQD VNTSIPMLRH EMCLCRVYVV SGSLRAFDRR PTRVTVAETS  180
SASAM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-34415820166NAC domain-containing protein 19
3swm_B6e-34415820166NAC domain-containing protein 19
3swm_C6e-34415820166NAC domain-containing protein 19
3swm_D6e-34415820166NAC domain-containing protein 19
3swp_A6e-34415820166NAC domain-containing protein 19
3swp_B6e-34415820166NAC domain-containing protein 19
3swp_C6e-34415820166NAC domain-containing protein 19
3swp_D6e-34415820166NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012838527.11e-100PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR34e-85NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A022RAV31e-100A0A022RAV3_ERYGU; Uncharacterized protein (Fragment)
STRINGSolyc11g068620.1.15e-92(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357